General Information

  • ID:  hor005615
  • Uniprot ID:  P09929
  • Protein name:  PDH precursor-related peptide
  • Gene name:  NA
  • Organism:  Romalea microptera (Eastern lubber grasshopper) (Romalea guttata)
  • Family:  Arthropod PDH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Romalea (genus), Romaleinae (subfamily), Romaleidae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LALTIQATQYEEDKYQENEVKYGRELASWLAQLAHKNEPAICAH
  • Length:  44(23-66)
  • Propeptide:  MTAMAVSGKLLTALVLSTYILGLALTIQATQYEEDKYQENEVKYGRELASWLAQLAHKNEPAICAHKRNSEIINSLLGLPKLLNDAGRK
  • Signal peptide:  MTAMAVSGKLLTALVLSTYILG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Capable of inducing pigment dispersion in the chromatophores of the fiddler crab Uca pugilator.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7Q7R8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005615_AF2.pdbhor005615_ESM.pdb

Physical Information

Mass: 584186 Formula: C225H347N61O71S
Absent amino acids: FM Common amino acids: A
pI: 4.86 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 16
Hydrophobicity: -67.73 Boman Index: -7917
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 84.55
Instability Index: 2936.36 Extinction Coefficient cystines: 9970
Absorbance 280nm: 231.86

Literature

  • PubMed ID:  3818616
  • Title:  Primary structure of an analog of crustacean pigment-dispersing hormone from the lubber grasshopper Romalea microptera.